PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00280g01015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family ZF-HD
Protein Properties Length: 289aa    MW: 32124 Da    PI: 7.931
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00280g01015.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.51.4e-3275129257
               ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                               +++rY+eClkNhAas+Gg+++DGCgEfmps geegt +alkCaAC+CHRnFHR+e+
  Peaxi162Scf00280g01015.1  75 SRARYRECLKNHAASIGGNVTDGCGEFMPS-GEEGTLEALKCAACNCHRNFHRKEQ 129
                               5789*************************9.999********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.7E-3077129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.2E-3178128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-2278128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.96179128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.38E-16218278IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28219281IPR009057Homeodomain-like
TIGRFAMsTIGR015651.1E-27220277IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MALTSNEDKE MRMQGSLEYH SLDQNIDQGN NNHSVPNHIL QPVVLQDQEK SSGHDGAITP  60
VMTYSGGGSK FKVASRARYR ECLKNHAASI GGNVTDGCGE FMPSGEEGTL EALKCAACNC  120
HRNFHRKEQP NVGGDNNAIM VVHPLQLPPS LPSPIPSMNH HHQHGRPVWT TMPAQPVKMA  180
FGGSGGSGAT DSSSEELNFN TYQQATSEHP QAQPPFVLAK KRFRTKFSQD QKEKMLEFAE  240
KLGWRIPRED DTEVQRFCSQ VGVKRQVFKV WMHNNKNPSA KKNPLQEEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A3e-242212771874ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4578119e-71CU457811.8 S.lycopersicum DNA sequence from clone LE_HBa-132M8 on chromosome 4, complete sequence.
GenBankCU4682399e-71CU468239.4 S.lycopersicum DNA sequence from clone SL_MboI-124K5 on chromosome 4, complete sequence.
GenBankHG9755169e-71HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009763792.11e-143PREDICTED: zinc-finger homeodomain protein 5-like
RefseqXP_016490581.11e-143PREDICTED: zinc-finger homeodomain protein 5-like
SwissprotQ9ZPW74e-63ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLM0ZWJ41e-123M0ZWJ4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000095811e-122(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.16e-60homeobox protein 33